PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34918.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 183aa    MW: 20915.7 Da    PI: 9.3068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34918.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.87e-201663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +G + Wkt+a + g++R++k+c++rw++yl
       KHN34918.1 16 RGAWTAEEDQKLAQCIEIHGAKKWKTVAIKSGLNRCGKSCRLRWLNYL 63
                     89********************************************97 PP

2Myb_DNA-binding543.8e-1769113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + eE++l+++++k+lG++ W++Ia++++ gRt++++k++w++ 
       KHN34918.1  69 RGNISVEEEDLIIRLHKLLGNR-WSLIAKRLP-GRTDNEIKNYWNTC 113
                      78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6771163IPR017930Myb domain
SuperFamilySSF466894.49E-3015110IPR009057Homeodomain-like
SMARTSM007171.4E-151565IPR001005SANT/Myb domain
PfamPF002491.5E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231770IPR009057Homeodomain-like
CDDcd001671.28E-101863No hitNo description
PROSITE profilePS5129425.51564118IPR017930Myb domain
SMARTSM007179.4E-1568116IPR001005SANT/Myb domain
PfamPF002491.0E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2571118IPR009057Homeodomain-like
CDDcd001673.24E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MAPPRNVETA KKTNNRGAWT AEEDQKLAQC IEIHGAKKWK TVAIKSGLNR CGKSCRLRWL  60
NYLRPNIKRG NISVEEEDLI IRLHKLLGNR WSLIAKRLPG RTDNEIKNYW NTCLCKKVNH  120
KKVKPETSTA QTTHTTQNTE ERAAVENKEG TDDGSGDSEV NFDVNEFFNF SIESGPFALD  180
WMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29161197109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150432e-74AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538747.11e-135PREDICTED: transcription factor MYB114-like
SwissprotP102908e-52MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0B2RRI41e-135A0A0B2RRI4_GLYSO; Anthocyanin regulatory C1 protein
TrEMBLK7LMV71e-135K7LMV7_SOYBN; Uncharacterized protein
STRINGGLYMA11G03770.21e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.14e-50myb domain protein 66
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]